Recombinant Human CA12

Name Recombinant Human CA12
Supplier Creative Biomart
Catalog CA12-26248TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O43570
Gene CA12
Sequence APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
Description Recombinant fragment corresponding to amino acids 25-124 of Human CA12 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag
Supplier Page Shop