| Name | Active mouse IL5 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181908 |
| Category | Protein |
| Prices | $860.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE ELISA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | Baculovirus infected insect cells |
| Purity | > 98 % by SDS-PAGE. ab181908 is 0.22 µm filtered. |
| Bioactivity | Measured by Human TF-1 cell proliferation assay. The ED 50 is 0.1 ng/ml, corresponding to a specific activity of 1.0 x 10 7 Units/mg. |
| SwissProt/Accession | P05113 |
| Gene | IL5 |
| Residue | 21 to 133 |
| Sequence | MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL DILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQE FLGVMSTEWAMEG |
| Supplier Page | Shop |