Active mouse IL31 full length protein
| Name | Active mouse IL31 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab119155 |
| Category | Protein |
| Prices | $210.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE HPLC |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. Protein content and purity of ab119155 was determined by UV spectroscopy at 280 nm, RP-HPLC calibrated against a known standard and quantitation against a known standard via reducing and non-reducing SDS-PAGE gels. |
| Bioactivity | The activity is determined by the dose dependent production of IL-8 from human PBMCs and is typically less than 25 ng/mL. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | Q6EBC2 |
| Gene | IL31 |
| Residue | 24 to 163 |
| Sequence | MTCSLSFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQL PCFSLDREALTNISVIIAHLEKVKVLSENTVDTSWVIRWLTNISCFNPLN LNISVPGNTDESYDCKVFVLTVLKQFSNCMAELQAKDNTTC |
| Supplier Page | Shop |
Product images
ab119155 used in Western Blot. Figure: 1 ug run under (+) reducing conditions and (-) non-reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse IL-31 has a predicted MW of 15.7 kDa.