Human VE Cadherin protein fragment
| Name | Human VE Cadherin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112269 |
| Category | Protein |
| Applications | SDS-PAGE Array WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P33151 |
| Gene | CDH5 |
| Residue | 51 to 150 |
| Sequence | WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETG DVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE Stained with Coomassie Blue.