| Name | Active mouse IL2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab183262 |
| Category | Protein |
| Prices | $188.00 |
| Sizes | 50 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | Insect cells |
| Purity | = 98 % by SDS-PAGE. ab183262 is purified by chromatography, then sterile filtered. |
| Bioactivity | ED50 < 5 ng/ml as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells (Gearing and Bird (1987) Production and assay of IL2. In Lymphokines and Interferons: A Practical Approach (Clemens et al. eds.) pp. 291-301). The ED50 for this effect is typically < 1.0 ng/ml. |
| SwissProt/Accession | P60568 |
| Gene | IL2 |
| Residue | 21 to 169 |
| Sequence | APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ |
| Supplier Page | Shop |