Mouse CD40L

Name Mouse CD40L
Supplier ABBIOTEC
Catalog 600177
Category Protein
Prices $250.00
Sizes 25 µg
Species Reactivities Mouse
Nature Recombinant
Source E. coli. Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.
Purity Purity > 98% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by RP-HPLC calibrated against a known standard and UV spectroscopy at 280 nm. Quantitation on SDS-PAGE against a known standard.
Bioactivity Recombinant mouse sCD40L is fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of T-47D cells is 84ng/ml.
Gene Cd40lg
Sequence MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLT VKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTH SSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVG FSSFGLLKL
Description CD40L or CD154 is a membrane glycoprotein and differentiation antigen expressed on the surface of T-cells. The CD40 ligand binds to TNFRSF5 and stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40 ligand has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2. The soluble form derives from the membrane form by proteolytic processing. Recombinant Mouse sCD40 ligand produced in E. coli is a non-glycosylated polypeptide chain containing 149 amino acids with a MW of 16,409 Da.
Supplier Page Shop