| Name | Active mouse IFN gamma full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198567 |
| Category | Protein |
| Prices | $300.00, $908.00 |
| Sizes | 100 µg, 500 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Protein Content and Purity (typically = 95%) determined by: Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. |
| Bioactivity | The activity is determined in an viral challenge assay using EMC virus on L929 cells and it is typically less than 0.2 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P01580 |
| Gene | Ifng |
| Residue | 23 to 155 |
| Sequence | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQII SFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEV NNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
| Supplier Page | Shop |