| Name | PLA2G10 Human |
|---|---|
| Supplier | NeoScientific |
| Catalog | ENPS-336 |
| Category | Protein |
| Prices | $65.00, $169.00, $5,070.00 |
| Sizes | 2 µg, 10 µg, 1 mg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia Coli. |
| Purity | Greater than 95% as determined by SDS PAGE. |
| Gene | PLA2G10 |
| Description | Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
| Supplier Page | Shop |