| Name | Active mouse GRO gamma full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191722 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Determined by its ability to chemoattract 293 transfected CXCR2 cells using a concentration range of 10.0-100 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P19876 |
| Gene | CXCL3 |
| Residue | 32 to 100 |
| Sequence | SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNP QGPRLQIIIKKILKSGKSS |
| Supplier Page | Shop |