| Name | Active mouse GRO alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab202817 |
| Category | Protein |
| Prices | $359.00 |
| Sizes | 5 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. Purity is determined by SDS-PAGE and HPLC analyses. |
| Bioactivity | ab202817 is fully biologically active when compared to standard, determined by its ability to chemoattract total Human neutrophils using a concentration range of 10.0-100.0 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09341 |
| Gene | CXCL1 |
| Residue | 25 to 96 |
| Sequence | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREA CLDPEAPLVQKIVQKMLKGVPK |
| Supplier Page | Shop |