TSC22D3 fusion protein

Name	TSC22D3 fusion protein
Supplier	Proteintech Group
Catalog	Ag3015
Category	Protein
Prices	$199.00
Sizes	50 μg
Species Reactivities	Human
Source	E. coli -derived, PGEX-4T
Tag/Conjugation	gst
Purity	80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Bioactivity	Not tested.
Endotoxin	Please contact the lab for more information.
Gene	TSC22D3
Sequence	LASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV (43 - 134 aa encoded by BC018148 )
Supplier Page	Shop