Human TGF beta induced factor 2 protein fragment
| Name | Human TGF beta induced factor 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab163719 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9GZN2 |
| Gene | TGIF2 |
| Residue | 114 to 175 |
| Sequence | LAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGST LTLLTRAEAGSP |
| Supplier Page | Shop |
Product images
ab163719 on a 12.5% SDS-PAGE stained with Coomassie Blue.