Human TGF alpha protein fragment
| Name | Human TGF alpha protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab152745 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P01135 |
| Gene | TGFA |
| Residue | 42 to 89 |
| Sequence | SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab152745 stained with Coomassie Blue.