| Name | Human TGF alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab151837 |
| Category | Protein |
| Applications | HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01135 |
| Gene | TGFA |
| Residue | 40 to 89 |
| Sequence | VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
| Supplier Page | Shop |