| Name | Active human VEGF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181896 |
| Category | Protein |
| Prices | $1,529.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. ab181896 is 0.22 um filtered. |
| Bioactivity | Measured by human umbilical vein endothelial cell (HUVEC) proliferation assay. The ED 50 is typically 10.0 ng/ml, corresponding to a specific activity of 1.0 x 10 5 Units/mg. |
| SwissProt/Accession | P15692 |
| Gene | VEGFA |
| Residue | 27 to 147 |
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR |
| Supplier Page | Shop |