Active human TRAIL protein fragment
| Name | Active human TRAIL protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168898 |
| Category | Protein |
| Prices | $643.00, $2,374.00 |
| Sizes | 20 µg, 500 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >= 99 % by SDS-PAGE. ab168898 is affinity purified and sterile filtered. |
| Bioactivity | Induces apoptosis in a concentration range of 10-100ng/ml. Does not require a cross-linking enhancer for its potent biological activity. ED50: 20 ng/ml (BJAB cells). |
| Endotoxin | <=0.040 Eu/µg |
| SwissProt/Accession | P50591 |
| Gene | TNFSF10 |
| Residue | 95 to 281 |
| Sequence | TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG |
| Supplier Page | Shop |
Product images
Apoptosis of TRAIL-sensitive cells. Concentration dependence of apoptosis induction in Jurkat and BJAB cells by ab168898 reveals high activity even at concentrations of 10-100 ng/ml.
Specificity of ab168898-induced apoptosis. Concentration dependent blocking of apoptosis induction of BJAB cells using MAb to Human TRAIL reveals specificity of ab168898-mediated killing.
Apoptosis of TRAIL-sensitive myeloid cell line ML-1.
Flow cytometry analysis of the TRAIL-sensitive human leukemia cell line HL60 and of TRAIL-resistant K572 cells using ab168898.