Active human TRAIL protein fragment
| Name | Active human TRAIL protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157018 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Induces apoptosis in U937 cells at 1µg/ml, within 5 hours. At 0.5-2.0µg/ml, induces apoptosis in various thyroid carcinoma lines within 18 hours. User must determine optimal concentrations and time course for induction. Please note that this protein does not require a cross-linking enhancer to exhibit this potent activity. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P50591 |
| Gene | TNFSF10 |
| Residue | 114 to 281 |
| Sequence | VRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSF LSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKY TSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNE HLIDMDHEASFFGAFLVG |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab157018 (4-20% acrylamide) stained with Coomassie Blue. MWs (kDa) of marker proteins are indicated by numbers to the left. NOTE: TRAIL migrates anomalously in this gel system, with an apparent MW of ~18 kDa.