Active human TRAIL protein fragment
| Name | Active human TRAIL protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157345 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 10 µg |
| Applications | WB FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >90% by SDS-PAGE. |
| Bioactivity | Binds to Human and mouse TRAIL receptors and Human osteoprotegerin (OPG). Induces apoptosis in a concentration range of 1-100ng/ml if applied with a cross-linking enhancer. Note: ab157345 does not significantly induce apoptosis in the absence of an enhancer. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P50591 |
| Gene | TNFSF10 |
| Residue | 95 to 281 |
| Sequence | TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG |
| Supplier Page | Shop |
Product images
SDS PAGE analysis of ab157345 (1µg).