Human S100G full length protein
| Name | Human S100G full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab96001 |
| Category | Protein |
| Applications | WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| SwissProt/Accession | P29377 |
| Gene | S100G |
| Residue | 2 to 79 |
| Sequence | MKHHHHHHA STKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPS LLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ |
| Supplier Page | Shop |
Product images
14% SDS-PAGE separation of Human S100G protein (ab96001) Lane 1. Molecular weight marker: 14, 21, 31, 45, 66 and 97 kDa Lane 2. Reduced and heated sample, 5 µg per lane Lane 3. Non reduced and non heated sample, 5 µg per lane