| Name | Active human Sumo 2 (mutated K11 R) full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab190028 |
| Category | Protein |
| Prices | $408.00 |
| Sizes | 250 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain. |
| Bioactivity | Typical in vitro concentrations for conjugate formation is 10-50 μM depending on conditions. |
| SwissProt/Accession | P61956 |
| Gene | SUMO2 |
| Residue | 1 to 95 |
| Sequence | MADEKPKEGVRTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| Supplier Page | Shop |