| Name | Recombinant Human MDC (67 a.a.) (CCL22) |
|---|---|
| Supplier | RayBiotech |
| Catalog | 213-10283-2 |
| Category | Protein |
| Prices | $190.00 |
| Sizes | 2 µg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia coli (E.coli) |
| Purity | 98% |
| Endotoxin | Endotoxin level is <0.1 ng/μg of protein (<1EU/μg). |
| Gene | ADAM11 |
| Sequence | YGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEIC ADPRVPWVKMILNKLSQ |
| Description | MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells |
| Supplier Page | Shop |