Proteasome 19S S7 Recombinant Protein Antigen

Name Proteasome 19S S7 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-56743PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Proteasome 19S S7 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PSMC2
Sequence KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Proteasome 19S S7
Supplier Page Shop