Active human MHC Class II Ia protein fragment
| Name | Active human MHC Class II Ia protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab174039 |
| Category | Protein |
| Prices | $428.00 |
| Sizes | 100 µg |
| Applications | ELISA SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized Human MHC Class II Ia at 5 μg/ml (100 μl/well) can bind biotinylated Human Cathepsin L1 with a linear range of 3.2 - 500 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04233 |
| Gene | CD74 |
| Residue | 73 to 232 |
| Sequence | QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGA LPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNT METIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGV TKQDLGPVPM |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of MHC Class II Ia in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced Protein migrates as 23-33 kDa due to glycosylation.