Recombinant Mouse Lymphocyte antigen 6G(Ly6g)

Name Recombinant Mouse Lymphocyte antigen 6G(Ly6g)
Supplier Cusabio
Catalog CSB-EP333994MOb0
Category Protein
Species Reactivities Mouse
Nature Recombinant
Source E.coli
Tag/Conjugation N-terminal 10xHis-tagged $("#dvInfo").change(
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P35461
Gene Ly6g
Residue 4--96aa
Sequence LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG
Description Full Length of Mature Protein
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.