Name | RNF20 Recombinant Protein Antigen |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP2-54995PEP |
Category | Protein |
Prices | $199.00 |
Sizes | 100 µl |
For Antibody | RNF20 Antibody |
Species Reactivities | Human |
Nature | Recombinant |
Source | E.coli |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Gene | RNF20 |
Sequence | IVNRYWSQFDENIRIILKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLAS |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF20 |
Supplier Page | Shop |