VN1R2 Recombinant Protein Antigen

Name VN1R2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48814PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody VN1R2 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene VN1R2
Sequence TTGKWSNNNITKKGDLGYCSAPLSDEVTKSVYAALTS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VN1R2
Supplier Page Shop