Human IL1 alpha protein

Name Human IL1 alpha protein
Supplier Biorbyt
Catalog orb49778
Category Protein
Prices $408.00, $595.00, $1,301.00, $1,828.00
Sizes 10 μg, 50 μg, 500 μg, 1 mg
Applications SDS-PAGE
Species Reactivities Mouse
Purity >95% as determined by reducing SDS-PAGE.
Bioactivity ED50 is less than 0.01 ng/ml as determined by the dosedependent stimulation of mouse D10S cells. Specific Activity of 1.0 x 108 IU/mg.
Endotoxin Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Gene Il1a
Sequence SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Description Recombinant human IL1 alpha protein
Supplier Page Shop