Active human IL33 full length protein
| Name | Active human IL33 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab155721 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | < 97 % by SDS-PAGE. |
| Bioactivity | Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells co-stimulated with anti-CD3. The ED 50 for this effect is typically 0.05-0.26 ng/ml. This protein has also been shown to induce IL13 secretion by D10.G4.1 cells under similar conditions. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O95760 |
| Gene | IL33 |
| Residue | 112 to 270 |
| Sequence | SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLL SYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKP LPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTE NILFKLSET |
| Supplier Page | Shop |
Product images
The purity of ab155721 was determined by reduced SDS-PAGE and staining overnight with Coomassie Blue.