Active human IL22 full length protein
| Name | Active human IL22 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab182710 |
| Category | Protein |
| Prices | $247.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells). The ED 50 for this effect is 0.5 - 1.0 ng/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9GZX6 |
| Gene | IL22 |
| Residue | 34 to 179 |
| Sequence | APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGV SMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCH IEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
| Supplier Page | Shop |
Product images
DTT-reduced SDS-PAGE analysis of ab182710 stained overnight with Coomassie Blue.