Human FPRL1 protein fragment
| Name | Human FPRL1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114357 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P25090 |
| Gene | FPR2 |
| Residue | 163 to 205 |
| Sequence | FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR |
| Supplier Page | Shop |
Product images
ab114357 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.