Active human IL12 full length protein
| Name | Active human IL12 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab201430 |
| Category | Protein |
| Prices | $280.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bio-activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20 ng/mL rhIL-2. The ED 50 < 0.2 ng/mL, corresponding to a specific activity of >5,000,000 Unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P29459 |
| Gene | IL12A |
| Residue | 23 to 219 |
| Sequence | RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHE DITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMAL CLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNF NSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Supplier Page | Shop |
Product images
The purity of ab201430 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced heterodimer protein migrates as 33-47 kDa due to glyosylation.