| Name | IDUA Recombinant Protein (OPCA02686) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02686 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P35475 |
| Gene | IDUA |
| Sequence | APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQ |
| Description | This gene encodes an enzyme that hydrolyzes the terminal alpha-L-iduronic acid residues of two glycosaminoglycans, dermatan sulfate and heparan sulfate |
| Supplier Page | Shop |