Name | SMARCC1 Recombinant Protein (OPCA02360) |
---|---|
Supplier | Aviva Systems Biology |
Catalog | OPCA02360 |
Category | Protein |
Prices | $250.00 |
Sizes | 50 µg |
Nature | Recombinant |
Source | Human |
Tag/Conjugation | His-SUMO-tag |
Purity | Greater than 90% as determined by SDS-PAGE. |
SwissProt/Accession | Q92922 |
Gene | SMARCC1 |
Sequence | IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL |
Description | The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes |
Supplier Page | Shop |