LCY1 Recombinant Protein (OPCA02278)

Name LCY1 Recombinant Protein (OPCA02278)
Supplier Aviva Systems Biology
Catalog OPCA02278
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Arabidopsis thaliana
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q38933
Gene LYC
Sequence QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERC
Description Encodes a protein with lycopene β-cyclase activity
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.