MUC2 Recombinant Protein (OPCA01740)

Name MUC2 Recombinant Protein (OPCA01740)
Supplier Aviva Systems Biology
Catalog OPCA01740
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q02817
Gene MUC2
Sequence VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Description This gene encodes a member of the mucin protein family
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.