IFNGR1 protein (Fc Chimera Active)
| Name | IFNGR1 protein (Fc Chimera Active) |
|---|---|
| Supplier | Abcam |
| Catalog | ab83990 |
| Category | Protein |
| Prices | $315.00 |
| Sizes | 25 µg |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | > 95 % by SDS-PAGE. |
| Bioactivity | The ED 50 of IFNGR1 (Fc Chimera) is typically 0.05-0.1 µg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line. |
| SwissProt/Accession | P15260 |
| Gene | IFNGR1 |
| Sequence | Theoretical sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKN YGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAY AKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDY DPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSL NSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGSSNTKVDKKVE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Supplier Page | Shop |
Product images
Lane 1 – MW markers; Lane 2 – ab83990; Lane 3 – ab83990 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83990 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 μg protein loaded per lane; Coomassie G250 stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
A sample of ab83990 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was loaded; Gel stained using Deep Purple™. Spot train indicates presence of multiple glycoforms. Spots within the spot train were cut from the gel and identified by protein mass fingerprinting as IFNGR1 (Fc Chimera).
Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification. The triangle indicates theoretical pI and MW of the protein.