C8B Recombinant Protein Antigen

Name C8B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85990PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C8B Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C8B
Sequence PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C8B. Source: E.coli Amino Acid Sequence: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Supplier Page Shop