Astrin Recombinant Protein Antigen

Name Astrin Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85262PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Astrin Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SPAG5
Sequence DTVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPAG5
Supplier Page Shop