CMC2 Recombinant Protein Antigen

Name CMC2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85289PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CMC2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CMC2
Sequence MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CMC2
Supplier Page Shop