Melanotransferrin/CD228/MFI2 Recombinant Protein Antigen

Name Melanotransferrin/CD228/MFI2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85777PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Melanotransferrin/CD228/MFI2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MFI2
Sequence RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFI2
Supplier Page Shop