| Name | Active human GRO alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab201394 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 5 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 97 % by SDS-PAGE. Purity is determined by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0 - 100.0 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09341 |
| Gene | CXCL1 |
| Residue | 25 to 96 |
| Sequence | APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREA CLDPEAPMVQKIVQKMLKGVPK |
| Supplier Page | Shop |