Anti-Creatine Kinase MM antibody
| Name | Anti-Creatine Kinase MM antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83441 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 71-120 (VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDD L) of Human CKM (NP_001815) |
| Description | Rabbit Polyclonal |
| Gene | CKM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Creatine Kinase MM antibody (ab83441) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted in 1/50000 - 1/100000 as secondary antibody.