Name | Anti-Coatomer subunit delta antibody |
---|---|
Supplier | Abcam |
Catalog | ab81651 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ICC/IF ICC/IF |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal ammino acids 289-338 (RDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKK L) of human Coatomer subunit delta (NP_001646) |
Description | Rabbit Polyclonal |
Gene | ARCN1 |
Conjugate | Unconjugated |
Supplier Page | Shop |