Anti-Coatomer subunit delta antibody

Name Anti-Coatomer subunit delta antibody
Supplier Abcam
Catalog ab81651
Prices $370.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF ICC/IF
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish
Antigen Synthetic peptide corresponding to a region within internal ammino acids 289-338 (RDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKK L) of human Coatomer subunit delta (NP_001646)
Description Rabbit Polyclonal
Gene ARCN1
Conjugate Unconjugated
Supplier Page Shop

Product images