| Name | FANCE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2296 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH |
| Purity/Format | Affinity purified |
| Blocking Peptide | FANCE Blocking Peptide |
| Description | Rabbit polyclonal FANCE antibody raised against the middle region of FANCE |
| Gene | FANCE |
| Supplier Page | Shop |