| Name | B3GALTL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7243 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | B3GALTL antibody was raised using the middle region of B3GALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE |
| Purity/Format | Affinity purified |
| Blocking Peptide | B3GALTL Blocking Peptide |
| Description | Rabbit polyclonal B3GALTL antibody raised against the middle region of B3GALTL |
| Gene | B3GALTL |
| Supplier Page | Shop |