HAGH antibody

Name HAGH antibody
Supplier Fitzgerald
Catalog 70R-4214
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD
Purity/Format Affinity purified
Blocking Peptide HAGH Blocking Peptide
Description Rabbit polyclonal HAGH antibody raised against the C terminal of HAGH
Gene HAGH
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.