Name | HAGH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4214 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | HAGH antibody was raised using the C terminal of HAGH corresponding to a region with amino acids STLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD |
Purity/Format | Affinity purified |
Blocking Peptide | HAGH Blocking Peptide |
Description | Rabbit polyclonal HAGH antibody raised against the C terminal of HAGH |
Gene | HAGH |
Supplier Page | Shop |