| Name | ATP7A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2740 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | ATP7A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | ATP7A Blocking Peptide |
| Description | Rabbit polyclonal ATP7A antibody |
| Gene | ATP7A |
| Supplier Page | Shop |