Name | ICA1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3830 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA |
Purity/Format | Affinity purified |
Blocking Peptide | ICA1 Blocking Peptide |
Description | Rabbit polyclonal ICA1 antibody raised against the C terminal of ICA1 |
Gene | ICA1 |
Supplier Page | Shop |