| Name | LDHAL6B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3958 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LDHAL6B antibody was raised using the middle region of LDHAL6B corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA |
| Purity/Format | Affinity purified |
| Blocking Peptide | LDHAL6B Blocking Peptide |
| Description | Rabbit polyclonal LDHAL6B antibody raised against the middle region of LDHAL6B |
| Gene | LDHAL6B |
| Supplier Page | Shop |