| Name | RPESP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3574 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPESP Blocking Peptide |
| Description | Rabbit polyclonal RPESP antibody raised against the middle region of RPESP |
| Gene | SBSPON |
| Supplier Page | Shop |